PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00015.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family ARF
Protein Properties Length: 819aa    MW: 90717.9 Da    PI: 5.6976
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00015.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B359.17.7e-191332012899
                              --..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                       B3  28 gkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                               ++++ ++l+++d++ ++W++++iyr++++r++lt+GW+ Fv +++L++gD+v+F   ++++ +l+v+v+r+
  Rsa1.0_00015.1_g00006.1 133 AQPPT-QELVVRDLHENTWTFRHIYRGQPKRHLLTTGWSLFVGSKRLRAGDSVLFI--RDEKSQLMVGVRRA 201
                              34433.48************************************************..4577778*****97 PP

2Auxin_resp108.38e-36227310183
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalk.vkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                              aaha++++++F +++nPra+++eFv++++k++ka+  +++svGmRf m+feteds +rr++Gt+vg+sd+dp+rW++SkWr+L+
  Rsa1.0_00015.1_g00006.1 227 AAHATANRTPFLIFFNPRACPAEFVIPLAKYRKAICgSQLSVGMRFGMMFETEDSGKRRYMGTIVGISDIDPLRWSGSKWRNLQ 310
                              79********************************9989********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010192.8E-10108202IPR003340B3 DNA binding domain
SuperFamilySSF1019363.14E-24126230IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.0E-24130208IPR015300DNA-binding pseudobarrel domain
PfamPF023623.2E-16130201IPR003340B3 DNA binding domain
CDDcd100171.66E-13135200No hitNo description
PROSITE profilePS5086311.251139202IPR003340B3 DNA binding domain
PfamPF065078.9E-31227310IPR010525Auxin response factor
PROSITE profilePS5174522.081710794IPR000270PB1 domain
SuperFamilySSF542771.37E-6724788No hitNo description
PfamPF023092.9E-6754795IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 819 aa     Download sequence    Send to blast
MMASVEDKMK TNSWANGGTK TTSQSTLLEE MKLLKDQSGT RKPVINSELW HACAGPLVCL  60
PQVGSLVYYF SQGHSEQVAV STRRSATTQV PNYPNLPSQL MCQVHNVTLH ADKDSDEIYA  120
QMSLQPVHSD YTAQPPTQEL VVRDLHENTW TFRHIYRGQP KRHLLTTGWS LFVGSKRLRA  180
GDSVLFIRDE KSQLMVGVRR ANRHQQTALP SSVLSADSMH IGVLAAAAHA TANRTPFLIF  240
FNPRACPAEF VIPLAKYRKA ICGSQLSVGM RFGMMFETED SGKRRYMGTI VGISDIDPLR  300
WSGSKWRNLQ VEWDEPGCND KPTRVSPWDI ETPESLFIFP SLTSGLKRQL HPSYFAGETE  360
WGSLIKRPLI RVSDSTNGIL PYASFPNMAS EQLMKMMMRP HNNNNNNNQN ATSSFMSEML  420
QQNVLMGHGG GLLGDMNMQQ PMVTSQKPEM VQQPESKITL NPSTAFNTTG QEQNLSQNMT  480
APPESEHHGN EQKSVEQASQ ARTVTVCNED ALSPLQAEPC PDTSQQIYPP QSDPINGFSF  540
LETEELTSFH SLAGSSLLSS QEDSSAVVLP DSTNSSLFHD VWDNQLSGLK FDQFSPLMQQ  600
DLYGCQDSTT SNILDPPPLS NTVLDDFCAI QNHHPSSDCL VGNSNTSFAQ DVQSSQITTA  660
GFADSKAFSR QDNSGGTTVT SSSNVDFDDS TLLQQNSKGS WQKLATPRVR TYTKVQKTGS  720
VGRSIDVTSF RDYKELKTAI ECMFGLEGLL TRPQSSGWKL VYVDYESDVL LVGDDPWKEF  780
VGCVRCIKIL SPAEVEQMSE EGMKLLNSAC INDLKTSVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A0.013351392Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794650.0JN979465.1 Brassica rapa subsp. pekinensis auxin response factor 5-1 (ARF5-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013641924.10.0PREDICTED: auxin response factor 5-like
SwissprotP930240.0ARFE_ARATH; Auxin response factor 5
TrEMBLA0A078GW890.0A0A078GW89_BRANA; Auxin response factor
STRINGfgenesh2_kg.1__2164__AT1G19850.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58082746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19850.10.0ARF family protein